HORDB

General Information

ID: hor006293
Uniprot ID: Q7KUD5
Protein name: Probable insulin-like peptide 5 A chain
Gene name: Ilp5
Organism: Drosophila melanogaster (Fruit fly)
Family: Insulin family
Source: animal
Expression: Expressed in the larva but not in the embryo. |Expressed at a high level in seven cells of each larval brain hemisphere that may correspond to neurosecretory cells. Expressed at a moderate level in the larval gut.
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005158 insulin receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity
GO BP: GO:0007623 circadian rhythm; GO:0007626 locomotory behavior; GO:0008286 insulin receptor signaling pathway; GO:0030431 sleep; GO:0033500 carbohydrate homeostasis; GO:0060180 female mating behavior; GO:0061964 negative regulation of entry into reproductive diapause
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: DFRGVVDSCCRKSCSFSTLRAYCDS
Length: 25(84-108)
Propeptide: MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
Signal peptide: MMFRSVIPVLLFLIPLLLSAQA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: NA
Mechanism: NA
Cross BBB: NA
Target: InR
Target Unid: P09208
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 45914
Structure ID: AF-Q7KUD5-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006293_AF2.pdb

hor006293_ESM.pdb

Physical Information

Mass:	323441	Formula:	C115H181N35O39S4
Absent amino acids:	EHIMNPQW	Common amino acids:	S
pI:	7.91	Basic residues:	4
Polar residues:	12	Hydrophobic residues:	6
Hydrophobicity:	-18.8	Boman Index:	-6935
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	42.8
Instability Index:	5407.2	Extinction Coefficient cystines:	1740
Absorbance 280nm:	72.5

Literature

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 11250149
Title: An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control.
PubMed ID: 14709175
Title: An i